What Can I Compare With The Pep Nation Lab Comparison Tool?

Any research-grade compound in the library can be placed side by side - up to four at a time. The tool compares mechanism of action, molecular target, evidence tier, molecular weight, amino acid sequence, reported half-life, and what each compound has been studied for, all drawn from referenced monographs.

What Does The Evidence Tier Mean?

The evidence tier reflects how extensively a compound has been studied in the referenced literature, from early preclinical signals through to compounds with human clinical data. It is a research-quality signal only, never a safety or efficacy endorsement.

How Are "X vs Y" Comparison Pages Built?

Each comparison page is generated from the same referenced compound database - a genuine side-by-side of mechanism, identity, pharmacokinetics, and evidence, plus data-derived key differences. They are curated, not auto-generated thin pages.

Is Any Of This Medical Or Dosing Advice?

No. Every comparison is for in vitro laboratory research use only. Nothing here is medical advice, a treatment recommendation, or dosing guidance, and no product is for human or animal consumption.

Compare Compounds

Select Up To Four Compounds To Review Their Evidence, Targets, And Handling Side By Side.
For Laboratory Research Only

2/4

Diff ModeHide Identical

VIPB85

KPVB+88

Top Pick: KPVTap to see full verdict & analysis

VIP

0/100

Grade B

Leads in scientific backing

Evidence

Safety

Science

Coverage

Handling

Depth

Unique: Sexual Health & Libido, Cognitive

KPV

0/100

Grade B+

Leads in safety profile

Evidence

Safety

Science

Coverage

Handling

Depth

Unique: Healing & Recovery, Pain & Inflammation

Research Profile Radar - hover axes for details

VIP

KPV

Zoom100%

Attribute	VIP B	KPV B+
Research Summary	VIP stands for Vasoactive Intestinal Peptide. It acts like a massive relaxer for your blood vessels and lungs, opening them up to increase blood flow, lower blood pressure, and heal toxic damage from mold.	KPV is the ultimate inflammation cooler. When your immune system is freaking out and causing red, swollen, angry issues (like in the gut or on the skin), KPV acts like a fire extinguisher to instantly calm it down.
Studied For	ARDS / acute respiratory failure researchPulmonary hypertensionSarcoidosis treatment researchErectile dysfunction (intracavernosal)COVID-19 respiratory complication researchGI motility modulationIntestinal inflammation / IBDNeurotransmission modulationVasodilation / blood pressureImmune modulationLung protectionAsthma researchPancreatic secretionCircadian rhythm modulationAnti-inflammatory cytokine modulationNeuroprotectiongut healthmold toxicityCIRSanti-inflammatorybronchodilationpulmonary hypertensionerectile dysfunctionimmune tolerance	GI inflammation / IBD researchUlcerative colitis modelsCrohn's disease modelsSkin inflammationWound healingImmune modulationNF-kB pathway inhibitionAnti-inflammatory cytokine reductionMucosal barrier integrityGut health restorationPsoriasis researchEczema researchColitis modelsMelanocortin receptor anti-inflammatorySystemic inflammation reductionOral peptide delivery researchanti-inflammatorygut healingCandidaIBDpsoriasismast cell stabilizationskin healingulcerative colitis
Research Areas	ImmuneGut Health & GI RepairSexual Health & LibidoCognitive	Gut Health & GI RepairImmuneHealing & RecoveryPain & InflammationSkin & Hair
Best Stacked With	ll-37thymosin-alpha-1bac-water	bpc-157ll-37thymosin-alpha-1lipo-cbac-water
Overview
Category	Immunity & Wellness	Healing & Recovery
Compound Class	28-amino acid neuropeptide and hormone; member of secretin/glucagon superfamily	Tripeptide C-terminal fragment of alpha-MSH (melanocyte-stimulating hormone)
Molecular Target	VPAC1 and VPAC2 receptors (VIP/PACAP receptors); cAMP/PKA signaling; vasodilation, bronchodilation, immune modulation, GI motility	MC1R / melanocortin receptors; NF-kB inhibition; reduces TNF-alpha, IL-1beta, IL-6 production; mucosal protection
Aliases / AKA	Vasoactive Intestinal PeptideAviptadilRLF-100VIP peptideVPAC agonistVasoactive intestinal polypeptide	Lys-Pro-ValAlpha-MSH tripeptide coreMSH fragmentKPV peptideAlpha-melanocyte-stimulating hormone C-terminal tripeptideAnti-inflammatory tripeptide
Parent Compound	Endogenous neuropeptide	alpha-MSH C-terminal fragment
Molecular Weight	3325.8 Da	342.43 Da
Amino Acid Sequence	`HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2`	`Lys-Pro-Val`
CAS Number	40077-57-4	67727-97-3
Year Discovered	Not Listed	Not Listed
Pro-Angiogenic	No	No
GLP-1 Class	No	No
Purity	Not Listed	Not Listed
Identity
Evidence Tier
Risk Level
PubMed Citations	46,941 Extensive	206 Good
Clinical Trials	3030 Active	Not Listed
Regulatory Status	FDA orphan designations but not approved; investigational.	Not FDA-approved; research chemical.
Evidence & Regulatory
Half-Life	~1-2 minutes	~1.5 hours
Typical Frequency	Not Listed	Not Listed
Administration Route	Injection Only	Injection Only
Mechanism / PK	Not Listed	Not Listed
Reported Findings	A large randomized COVID-19 trial of IV aviptadil did not significantly improve outcomes. VIP with phentolamine is approved for erectile dysfunction in some countries.	Cell and mouse colitis studies report reduced inflammation and mucosal healing, often using targeted nanoparticle delivery. Human efficacy is not established.
Side Effects Noted	SAFETY FLAG: infusion hypotension, diarrhea, and facial flushing; high-dose VIP can cause severe secretory diarrhea with acid-base disturbance.	Preclinical tolerability is good with low toxicity; no meaningful human adverse-event data.
Warnings	Hypotension can be clinically important and warrants monitoring; efficacy in respiratory disease is unproven. Investigational.	No approved human indication. Research use only.
Pharmacology
Form	lyophilized	lyophilized
Diluent	sterile water; slow controlled IV infusion	sterile or bacteriostatic water
Storage Temp	cold, dark	cold, dry
Light Sensitive	Yes	Yes
Freeze / Thaw	avoid	avoid
Handling Notes	Chemically labile; adsorbs to surfaces.	Small, relatively stable tripeptide.
Reconstituted Shelf Life	7 Days Refrigerated	28 Days Refrigerated
Handling & Storage

Popular Research Comparisons

BPC-157 vs TB-500 / Thymosin Beta-4
The two most-studied research peptides for tissue repair and recovery.
Semaglutide vs Tirzepatide
Single GLP-1 versus dual GLP-1/GIP incretin agonists in metabolic research.
Tirzepatide vs Retatrutide
Dual versus triple incretin receptor agonists in weight-research models.
Semaglutide vs Retatrutide
A GLP-1 agonist versus a triple-agonist incretin in metabolic research.
CJC-1295 With DAC vs Ipamorelin
A GHRH analog versus a selective ghrelin-receptor secretagogue.
Ipamorelin vs Sermorelin
A ghrelin-receptor secretagogue versus a GHRH analog for growth-hormone research.
Sermorelin vs Tesamorelin
Two GHRH analogs studied on the growth-hormone axis.
GHRP-2 vs GHRP-6
The two first-generation growth-hormone releasing peptides.
Cagrilintide vs Semaglutide
An amylin analog versus a GLP-1 agonist in metabolic research.
MOTS-c vs AOD9604
A mitochondrial-derived peptide versus an HGH fragment in metabolic research.
PT-141 vs Kisspeptin-10
Melanocortin versus kisspeptin pathways in reproductive research.
Epithalon vs NAD+
A telomerase-pathway peptide versus NAD+ metabolism in longevity research.
Hexarelin vs Ipamorelin
A potent versus a highly selective ghrelin-receptor secretagogue.
CJC-1295 With DAC vs Tesamorelin
Two GHRH analogs with contrasting half-life profiles.
IGF-1 LR3 vs Ipamorelin
A direct IGF-1 analog versus a growth-hormone secretagogue.
CJC-1295 With DAC vs CJC-1295 Without DAC
The DAC versus non-DAC forms of the CJC-1295 GHRH analog.
Selank vs Semax
Two Russian-developed nootropic and anxiolytic research peptides.
SS-31 vs MOTS-c
Two mitochondrial-targeted peptides in cellular-energy research.
Thymosin Alpha-1 vs LL-37
Two immune-modulating research peptides with distinct mechanisms.
AOD9604 vs HGH Fragment 176-191
Two HGH-fragment analogs studied for fat-metabolism research.
Retatrutide vs Survodutide
Next-generation multi-receptor incretin agonists in metabolic research.
BPC-157 vs GHK-Cu
Two leading tissue-repair peptides with distinct healing mechanisms.
TB-500 / Thymosin Beta-4 vs GHK-Cu
A systemic repair peptide versus a copper peptide for tissue and skin research.
Tesamorelin vs Ipamorelin
A GHRH analog versus a selective ghrelin-receptor secretagogue on the GH axis.
Tirzepatide vs Cagrilintide
A dual incretin agonist versus an amylin analog in metabolic research.
Retatrutide vs Cagrilintide
A triple incretin agonist versus an amylin analog in weight research.
MOTS-c vs 5-Amino-1MQ
Two metabolic research compounds targeting mitochondrial and NNMT pathways.
NAD+ vs MOTS-c
NAD+ metabolism versus a mitochondrial-derived peptide in longevity research.
GHK-Cu vs AHK-Cu
Two copper research peptides studied for skin and hair.
CJC-1295 With DAC vs Sermorelin
A long-acting versus a short-acting GHRH analog.
Ipamorelin vs GHRP-6
A selective versus a first-generation ghrelin-receptor secretagogue.
Semaglutide vs The Appetite Crusher Stack
A GLP-1 agonist versus a GLP-1/amylin combination in metabolic research.
BPC-157 vs KPV
Two peptides studied for gut and mucosal repair.
PT-141 vs Oxytocin
Melanocortin versus oxytocin pathways in intimacy and libido research.
Thymosin Alpha-1 vs Thymalin
Two thymic immune-modulating research peptides.
Selank vs DSIP
An anxiolytic nootropic versus a sleep-associated research peptide.
IGF-1 LR3 vs Follistatin
Direct IGF-1 signaling versus myostatin inhibition in muscle research.
SS-31 vs NAD+
A mitochondrial-targeted peptide versus NAD+ in cellular-energy research.
BPC-157 vs The Wolverine Stack
Single BPC-157 versus the combined BPC-157 and TB-500 blend in recovery research.
Ipamorelin vs The Fountain of Youth Stack
Ipamorelin alone versus the CJC-1295 and ipamorelin blend on the growth-hormone axis.
Semax vs Cerebrolysin
A synthetic ACTH-fragment nootropic versus a neurotrophic peptide preparation in cognitive research.
Melatonin vs DSIP
Two sleep-research compounds with distinct mechanisms.
GHK-Cu vs SNAP-8
A copper tripeptide versus an acetyl hexapeptide in cosmetic and skin research.
FOXO4-DRI vs Epithalon
A senolytic peptide versus a telomerase-pathway peptide in longevity research.
AICAR vs 5-Amino-1MQ
Two metabolic research compounds targeting the AMPK and NNMT pathways.
Tesamorelin vs HGH Fragment 176-191
A GHRH analog versus an HGH fragment in fat-metabolism research.
MOTS-c vs AICAR
Two AMPK-associated mitochondrial and metabolic research compounds.
ARA-290 vs BPC-157
Two peptides studied for tissue protection and repair.
VIP vs KPV
Two peptides studied for immune and inflammatory modulation.
Pinealon vs Epithalon
Two peptide bioregulators studied in longevity and neuro research.
Survodutide vs Tirzepatide
A glucagon/GLP-1 dual agonist versus a GIP/GLP-1 dual agonist in metabolic research.

Accessing Library

Compare Compounds

Compare Research Peptides Side By Side

Popular Research Comparisons

Compounds You Can Compare

Comparison Tool FAQ