LL-37

Also Known As: Cathelicidin, hCAP-18 fragment, CAP-18, LL37, hCAP18, Cathelicidin antimicrobial peptide, Human cathelicidin, CAMP peptide, Host defense peptide LL-37, Innate immunity peptide, Antimicrobial host defense peptide, Wound healing antimicrobial peptide, LL-37 peptide, Cathelicidin LL-37, antimicrobial peptide, cathelicidin

LL-37 is a research-grade Endogenous cationic host defense peptide targeting Bacterial membrane disruption studied in Immunity & Wellness research. It is supplied strictly for in vitro laboratory research use only - not for human or animal consumption, and not FDA-approved.

Evidence Tier: Research Compound - No approved human use; sold for laboratory research only.

The human antimicrobial peptide, studied for infection and immunity; can also promote autoimmunity.

At A Glance

LL-37 Key Research Facts
CategoryImmunity & Wellness
Compound ClassEndogenous cationic host defense peptide (cathelicidin family); 37-residue C-terminal fragment of hCAP-18
Molecular TargetBacterial membrane disruption; TLR4 and FPRL1 receptor signaling; EGFR transactivation; immunomodulatory cytokine network
Molecular Weight4493.3 Da
Amino Acid SequenceLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
CAS Number154947-66-7
Half-Life~30 minutes
WADA Statusnot_listed
Evidence TierResearch Compound

Mechanism Of Action

It is a natural antimicrobial peptide. It binds directly to the outer layer of harmful bacteria and viruses and ruptures their membranes, causing them to die instantly.

Studied For

  • Antimicrobial / antibiofilm research
  • Wound healing
  • Innate immunity modulation
  • Autoimmune disease research
  • Bacterial biofilm disruption
  • MRSA research
  • Viral infection defense models
  • Fungal infection research
  • Gut microbiome modulation
  • Inflammatory bowel disease models
  • Cancer immunology research
  • Lung infection / cystic fibrosis models
  • Skin infection treatment research
  • Angiogenesis promotion
  • Wound re-epithelialization
  • Sepsis research
  • Immune cell recruitment
  • Chemotaxis of neutrophils and monocytes
  • antibacterial
  • antiviral
  • biofilm disruption
  • immune support
  • gut infections
  • wound healing
  • Lyme disease
  • autoimmune

Reported Research Findings

In vitro it has broad antimicrobial and LPS-neutralizing activity; animal data show host-defense and wound roles. Human use is investigational.

Safety And Handling Notes

Context-dependent host-cell cytotoxicity at higher concentrations; can be pro-inflammatory and has been implicated in lupus and psoriasis pathology; hemolytic potential.

Double-edged immunomodulation can drive autoimmunity; activity is highly salt and serum sensitive. Not approved; research reagent.

Regulatory Status

Not approved; research reagent.

Full Reference Detail

Related Research Guides

Maintained By The Pep Nation Lab Research Team. See Our Editorial Standards And Research Methodology For How This Reference Is Sourced And Reviewed.

This Reference Is Provided For In Vitro Laboratory Research Use Only. Not For Human Consumption. See The Full Research Disclaimer.

References And Citations

  1. en.wikipedia.org
  2. PubMed / NCBI Reference
Spec Sheet

LL-37

Also Known As: Cathelicidin, hCAP-18 fragment, CAP-18, LL37, hCAP18, Cathelicidin antimicrobial peptide, Human cathelicidin, CAMP peptide, Host defense peptide LL-37, Innate immunity peptide, Antimicrobial host defense peptide, Wound healing antimicrobial peptide, LL-37 peptide, Cathelicidin LL-37, antimicrobial peptide, cathelicidin

Research CompoundImmunity & Wellness

Explain Like I'm 5

  • LL-37 is your immune system's natural SWAT team. It physically punches holes in bad bacteria, viruses, and fungi to destroy them, while also helping nearby wounds heal faster.

The human antimicrobial peptide, studied for infection and immunity; can also promote autoimmunity.

Identity & Classification
LL-37 Key Research Facts
ClassEndogenous cationic host defense peptide (cathelicidin family); 37-residue C-terminal fragment of hCAP-18
Molecular TargetBacterial membrane disruption; TLR4 and FPRL1 receptor signaling; EGFR transactivation; immunomodulatory cytokine network
CategoryImmunity & Wellness
Molecular Weight4493.3 Da
Amino Acid SequenceLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
CAS Number154947-66-7
Parent CompoundHuman cathelicidin hCAP18
Research Metrics at a Glance
4,797
PubMed Citations
24
Clinical Trials
24 Active

Sequence

37 Residues· 4493.3 Da
[LL-37, 37 aa]
HydrophobicPolar / OtherAcidicBasic

Related Compounds

Research Use Only. Not For Human Or Veterinary Use. Information Provided For Laboratory Research Purposes Only.

Research Reference Only — Not Medical Advice. For In Vitro Laboratory Use Only.
Typical Dose0.5–2 mg
FrequencyOnce daily to every other day
Cycle On4–8 weeks
Cycle Off4 weeks
Route(s)
SubcutaneousTopicalInhalation (pulmonary research)
Research Notes

Human cathelicidin antimicrobial peptide. Antimicrobial, immunomodulatory, and wound-healing research. High doses may be pro-inflammatory. Topical formulations at 0.1–1% for wound care research. Stability is relatively poor; use immediately after reconstitution.

Sequence Motif Viewer

37 Residues
[LL-37, 37 aa]
BasicAcidicPolarNon-PolarAromaticSpecial
CompoundCompoundTargetReceptor / TargetIt is a natural anti...Downstream PathwayResearch EffectStudied Effect

Compare LL-37

LL-37 Frequently Asked Questions

What Is LL-37?

The human antimicrobial peptide, studied for infection and immunity; can also promote autoimmunity.

How Does LL-37 Work?

It is a natural antimicrobial peptide. It binds directly to the outer layer of harmful bacteria and viruses and ruptures their membranes, causing them to die instantly.

What Has LL-37 Been Studied For?

In the referenced literature, LL-37 has been studied for Antimicrobial / antibiofilm research, Wound healing, Innate immunity modulation, Autoimmune disease research, Bacterial biofilm disruption, MRSA research, Viral infection defense models, Fungal infection research, Gut microbiome modulation, Inflammatory bowel disease models, Cancer immunology research, Lung infection / cystic fibrosis models, Skin infection treatment research, Angiogenesis promotion, Wound re-epithelialization, Sepsis research, Immune cell recruitment, Chemotaxis of neutrophils and monocytes, antibacterial, antiviral, biofilm disruption, immune support, gut infections, wound healing, Lyme disease, autoimmune. This summarizes research focus only and is not a claim of efficacy.

What Is The Reported Half-Life Of LL-37?

LL-37 has a reported half-life of ~30 minutes in the referenced literature.

Is LL-37 Approved For Human Use?

No. LL-37 is supplied strictly for in vitro laboratory research use only. It is not intended for human or animal consumption, ingestion, or injection, and it has not been evaluated by the FDA.

Regional Research Availability

Pep Nation Lab supplies research-grade LL-37 to qualified researchers and scientific institutions nationwide. Browse verified availability and per-region documentation by state:

Featured Research Hubs