LL-37
Also Known As: Cathelicidin, hCAP-18 fragment, CAP-18, LL37, hCAP18, Cathelicidin antimicrobial peptide, Human cathelicidin, CAMP peptide, Host defense peptide LL-37, Innate immunity peptide, Antimicrobial host defense peptide, Wound healing antimicrobial peptide, LL-37 peptide, Cathelicidin LL-37, antimicrobial peptide, cathelicidin
LL-37 is a research-grade Endogenous cationic host defense peptide targeting Bacterial membrane disruption studied in Immunity & Wellness research. It is supplied strictly for in vitro laboratory research use only - not for human or animal consumption, and not FDA-approved.
Evidence Tier: Research Compound - No approved human use; sold for laboratory research only.
The human antimicrobial peptide, studied for infection and immunity; can also promote autoimmunity.
At A Glance
| Category | Immunity & Wellness |
|---|---|
| Compound Class | Endogenous cationic host defense peptide (cathelicidin family); 37-residue C-terminal fragment of hCAP-18 |
| Molecular Target | Bacterial membrane disruption; TLR4 and FPRL1 receptor signaling; EGFR transactivation; immunomodulatory cytokine network |
| Molecular Weight | 4493.3 Da |
| Amino Acid Sequence | [LL-37, 37 aa] |
| CAS Number | 154947-66-7 |
| Half-Life | ~30 minutes |
| WADA Status | not_listed |
| Evidence Tier | Research Compound |
Mechanism Of Action
It is a natural antimicrobial peptide. It binds directly to the outer layer of harmful bacteria and viruses and ruptures their membranes, causing them to die instantly.
Studied For
- Antimicrobial / antibiofilm research
- Wound healing
- Innate immunity modulation
- Autoimmune disease research
- Bacterial biofilm disruption
- MRSA research
- Viral infection defense models
- Fungal infection research
- Gut microbiome modulation
- Inflammatory bowel disease models
- Cancer immunology research
- Lung infection / cystic fibrosis models
- Skin infection treatment research
- Angiogenesis promotion
- Wound re-epithelialization
- Sepsis research
- Immune cell recruitment
- Chemotaxis of neutrophils and monocytes
- antibacterial
- antiviral
- biofilm disruption
- immune support
- gut infections
- wound healing
- Lyme disease
- autoimmune
Reported Research Findings
In vitro it has broad antimicrobial and LPS-neutralizing activity; animal data show host-defense and wound roles. Human use is investigational.
Safety And Handling Notes
Context-dependent host-cell cytotoxicity at higher concentrations; can be pro-inflammatory and has been implicated in lupus and psoriasis pathology; hemolytic potential.
Double-edged immunomodulation can drive autoimmunity; activity is highly salt and serum sensitive. Not approved; research reagent.
Regulatory Status
Not approved; research reagent.
Full Reference Detail
Related Research Guides
Maintained By The Pep Nation Lab Research Team. See Our Editorial Standards And Research Methodology For How This Reference Is Sourced And Reviewed.
This Reference Is Provided For In Vitro Laboratory Research Use Only. Not For Human Consumption. See The Full Research Disclaimer.