VIP

Also Known As: Vasoactive Intestinal Peptide, Aviptadil, RLF-100, VIP peptide, VPAC agonist, Vasoactive intestinal polypeptide, VIP neuropeptide, Aviptadil COVID, VIP ARDS treatment, Intestinal neuropeptide VIP, Vasorelaxant peptide, Pituitary adenylate cyclase peptide family, PACAP-related peptide

VIP is a research-grade 28-amino acid neuropeptide and hormone targeting VPAC1 and VPAC2 receptors studied in Immunity & Wellness research. It is supplied strictly for in vitro laboratory research use only - not for human or animal consumption, and not FDA-approved.

Evidence Tier: Investigational - In active human clinical trials; not yet approved.

A vasodilating peptide hormone studied for lung disease; carries a notable low-blood-pressure risk.

At A Glance

VIP Key Research Facts
CategoryImmunity & Wellness
Compound Class28-amino acid neuropeptide and hormone; member of secretin/glucagon superfamily
Molecular TargetVPAC1 and VPAC2 receptors (VIP/PACAP receptors); cAMP/PKA signaling; vasodilation, bronchodilation, immune modulation, GI motility
Molecular Weight3325.8 Da
Amino Acid SequenceHSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
CAS Number40077-57-4
Half-Life~1-2 minutes
WADA Statusnot_listed
Evidence TierInvestigational

Mechanism Of Action

It binds to VIP receptors throughout the body, causing smooth muscle relaxation. This dilates blood vessels, reduces systemic inflammation, and has been uniquely effective in reversing chronic inflammatory response syndrome (CIRS).

Studied For

  • ARDS / acute respiratory failure research
  • Pulmonary hypertension
  • Sarcoidosis treatment research
  • Erectile dysfunction (intracavernosal)
  • COVID-19 respiratory complication research
  • GI motility modulation
  • Intestinal inflammation / IBD
  • Neurotransmission modulation
  • Vasodilation / blood pressure
  • Immune modulation
  • Lung protection
  • Asthma research
  • Pancreatic secretion
  • Circadian rhythm modulation
  • Anti-inflammatory cytokine modulation
  • Neuroprotection
  • gut health
  • mold toxicity
  • CIRS
  • anti-inflammatory
  • bronchodilation
  • pulmonary hypertension
  • erectile dysfunction
  • immune tolerance

Reported Research Findings

A large randomized COVID-19 trial of IV aviptadil did not significantly improve outcomes. VIP with phentolamine is approved for erectile dysfunction in some countries.

Safety And Handling Notes

SAFETY FLAG: infusion hypotension, diarrhea, and facial flushing; high-dose VIP can cause severe secretory diarrhea with acid-base disturbance.

Hypotension can be clinically important and warrants monitoring; efficacy in respiratory disease is unproven. Investigational.

Regulatory Status

FDA orphan designations but not approved; investigational.

Full Reference Detail

Related Research Guides

Maintained By The Pep Nation Lab Research Team. See Our Editorial Standards And Research Methodology For How This Reference Is Sourced And Reviewed.

This Reference Is Provided For In Vitro Laboratory Research Use Only. Not For Human Consumption. See The Full Research Disclaimer.

References And Citations

  1. PubMed / NCBI Reference
  2. thelancet.com
Spec Sheet

VIP

Also Known As: Vasoactive Intestinal Peptide, Aviptadil, RLF-100, VIP peptide, VPAC agonist, Vasoactive intestinal polypeptide, VIP neuropeptide, Aviptadil COVID, VIP ARDS treatment, Intestinal neuropeptide VIP, Vasorelaxant peptide, Pituitary adenylate cyclase peptide family, PACAP-related peptide

InvestigationalImmunity & Wellness

Explain Like I'm 5

  • VIP stands for Vasoactive Intestinal Peptide. It acts like a massive relaxer for your blood vessels and lungs, opening them up to increase blood flow, lower blood pressure, and heal toxic damage from mold.

A vasodilating peptide hormone studied for lung disease; carries a notable low-blood-pressure risk.

Identity & Classification
VIP Key Research Facts
Class28-amino acid neuropeptide and hormone; member of secretin/glucagon superfamily
Molecular TargetVPAC1 and VPAC2 receptors (VIP/PACAP receptors); cAMP/PKA signaling; vasodilation, bronchodilation, immune modulation, GI motility
CategoryImmunity & Wellness
Molecular Weight3325.8 Da
Amino Acid SequenceHSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
CAS Number40077-57-4
Parent CompoundEndogenous neuropeptide
Research Metrics at a Glance
47,471
PubMed Citations
30
Clinical Trials
30 Active

Related Compounds

Research Use Only. Not For Human Or Veterinary Use. Information Provided For Laboratory Research Purposes Only.

Research Reference Only — Not Medical Advice. For In Vitro Laboratory Use Only.
Typical Dose50–100 pmol/kg/min (IV infusion in research); 0.1–1 mcg intranasal
FrequencyIntranasal: 2–3 times daily. IV: continuous infusion in research settings.
Cycle On2–4 weeks (intranasal research)
Cycle Off2–4 weeks
Route(s)
IntranasalIntravenous (infusion)Subcutaneous
Research Notes

Vasoactive Intestinal Peptide. MCAS, inflammatory bowel, pulmonary hypertension, and CIRS research. Very short plasma half-life (~2 min). Intranasal routes used for CNS and mucosal delivery. IV infusion for systemic vasodilatory research. Flushing and hypotension at higher IV doses.

Sequence Motif Viewer

32 Residues
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
BasicAcidicPolarNon-PolarAromaticSpecial
CompoundCompoundTargetReceptor / TargetIt binds to VIP rece...Downstream PathwayResearch EffectStudied Effect

Compare VIP

VIP Frequently Asked Questions

What Is VIP?

A vasodilating peptide hormone studied for lung disease; carries a notable low-blood-pressure risk.

How Does VIP Work?

It binds to VIP receptors throughout the body, causing smooth muscle relaxation. This dilates blood vessels, reduces systemic inflammation, and has been uniquely effective in reversing chronic inflammatory response syndrome (CIRS).

What Has VIP Been Studied For?

In the referenced literature, VIP has been studied for ARDS / acute respiratory failure research, Pulmonary hypertension, Sarcoidosis treatment research, Erectile dysfunction (intracavernosal), COVID-19 respiratory complication research, GI motility modulation, Intestinal inflammation / IBD, Neurotransmission modulation, Vasodilation / blood pressure, Immune modulation, Lung protection, Asthma research, Pancreatic secretion, Circadian rhythm modulation, Anti-inflammatory cytokine modulation, Neuroprotection, gut health, mold toxicity, CIRS, anti-inflammatory, bronchodilation, pulmonary hypertension, erectile dysfunction, immune tolerance. This summarizes research focus only and is not a claim of efficacy.

What Is The Reported Half-Life Of VIP?

VIP has a reported half-life of ~1-2 minutes in the referenced literature.

Is VIP Approved For Human Use?

No. VIP is supplied strictly for in vitro laboratory research use only. It is not intended for human or animal consumption, ingestion, or injection, and it has not been evaluated by the FDA.

Regional Research Availability

Pep Nation Lab supplies research-grade VIP to qualified researchers and scientific institutions nationwide. Browse verified availability and per-region documentation by state:

Featured Research Hubs