Technical Data Sheet

VIP

Also Known As: Vasoactive Intestinal Peptide, Aviptadil, RLF-100, VIP peptide, VPAC agonist, Vasoactive intestinal polypeptide, VIP neuropeptide, Aviptadil COVID, VIP ARDS treatment, Intestinal neuropeptide VIP, Vasorelaxant peptide, Pituitary adenylate cyclase peptide family, PACAP-related peptide

Scan To View Profile

Evidence Tier	Investigational
Category	Immunity & Wellness
Class	28-amino acid neuropeptide and hormone; member of secretin/glucagon superfamily
Molecular Target	VPAC1 and VPAC2 receptors (VIP/PACAP receptors); cAMP/PKA signaling; vasodilation, bronchodilation, immune modulation, GI motility
Sequence	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Molecular Weight	~3326 Da
CAS	40077-57-4
Parent	Endogenous neuropeptide
Mechanism	It binds to VIP receptors throughout the body, causing smooth muscle relaxation. This dilates blood vessels, reduces systemic inflammation, and has been uniquely effective in reversing chronic inflammatory response syndrome (CIRS).
Studied For	ARDS / acute respiratory failure research, Pulmonary hypertension, Sarcoidosis treatment research, Erectile dysfunction (intracavernosal), COVID-19 respiratory complication research, GI motility modulation, Intestinal inflammation / IBD, Neurotransmission modulation, Vasodilation / blood pressure, Immune modulation, Lung protection, Asthma research, Pancreatic secretion, Circadian rhythm modulation, Anti-inflammatory cytokine modulation, Neuroprotection, gut health, mold toxicity, CIRS, anti-inflammatory, bronchodilation, pulmonary hypertension, erectile dysfunction, immune tolerance
Administration Route	Injection Only
Form	lyophilized
Diluent	sterile water; slow controlled IV infusion
Storage Temperature	cold, dark
Light Sensitive	Yes
Freeze / Thaw	avoid
Reconstituted Shelf Life	7 Days
Handling Notes	Chemically labile; adsorbs to surfaces.
Regulatory	FDA orphan designations but not approved; investigational.
Sources