Technical Data Sheet

LL-37

Also Known As: Cathelicidin, hCAP-18 fragment, CAP-18, LL37, hCAP18, Cathelicidin antimicrobial peptide, Human cathelicidin, CAMP peptide, Host defense peptide LL-37, Innate immunity peptide, Antimicrobial host defense peptide, Wound healing antimicrobial peptide, LL-37 peptide, Cathelicidin LL-37, antimicrobial peptide, cathelicidin

Scan To View Profile

Evidence Tier	Research Compound
Category	Immunity & Wellness
Class	Endogenous cationic host defense peptide (cathelicidin family); 37-residue C-terminal fragment of hCAP-18
Molecular Target	Bacterial membrane disruption; TLR4 and FPRL1 receptor signaling; EGFR transactivation; immunomodulatory cytokine network
Sequence	[LL-37, 37 aa]
Molecular Weight	~4493 Da
CAS	154947-66-7
Parent	Human cathelicidin hCAP18
Mechanism	It is a natural antimicrobial peptide. It binds directly to the outer layer of harmful bacteria and viruses and ruptures their membranes, causing them to die instantly.
Studied For	Antimicrobial / antibiofilm research, Wound healing, Innate immunity modulation, Autoimmune disease research, Bacterial biofilm disruption, MRSA research, Viral infection defense models, Fungal infection research, Gut microbiome modulation, Inflammatory bowel disease models, Cancer immunology research, Lung infection / cystic fibrosis models, Skin infection treatment research, Angiogenesis promotion, Wound re-epithelialization, Sepsis research, Immune cell recruitment, Chemotaxis of neutrophils and monocytes, antibacterial, antiviral, biofilm disruption, immune support, gut infections, wound healing, Lyme disease, autoimmune
Administration Route	Injection Only
Form	lyophilized
Diluent	sterile water (salt-sensitive)
Storage Temperature	frozen, dark
Light Sensitive	Yes
Freeze / Thaw	avoid
Reconstituted Shelf Life	14 Days
Handling Notes	Adsorbs to glass/plastic and aggregates.
Regulatory	Not approved; research reagent.
Sources