Accessing Library
Connecting to Pep Nation Lab's research database...
Connecting to Pep Nation Lab's research database...
Select Up To Four Compounds To Review Their Evidence, Targets, And Handling Side By Side.
For Laboratory Research Only
| Attribute | ||
|---|---|---|
Research Summary | Thymosin Alpha-1 is a powerful immune system booster. Whether you are fighting a bad virus, a chronic illness, or just getting sick too often, it flips the immune system on full blast to clear the threat. | LL-37 is your immune system's natural SWAT team. It physically punches holes in bad bacteria, viruses, and fungi to destroy them, while also helping nearby wounds heal faster. |
Studied For | Chronic hepatitis B treatmentChronic hepatitis C treatmentCancer immune adjunct therapyVaccine adjuvantSepsis / severe infectionCOVID-19 immune support researchImmunodeficiency modelsHIV / AIDS immune supportAntifungal immune supportMalignant melanoma adjuvantLung cancer immune researchT-cell / NK cell activationDendritic cell maturationToll-like receptor signalingAutoimmune modulationGut mucosal immunityChemotherapy immune protectionimmune boosterT-cell modulationviral infectionautoimmuneimmunomodulatorLyme diseasechronic fatiguecancer adjunctivevaccine efficacy | Antimicrobial / antibiofilm researchWound healingInnate immunity modulationAutoimmune disease researchBacterial biofilm disruptionMRSA researchViral infection defense modelsFungal infection researchGut microbiome modulationInflammatory bowel disease modelsCancer immunology researchLung infection / cystic fibrosis modelsSkin infection treatment researchAngiogenesis promotionWound re-epithelializationSepsis researchImmune cell recruitmentChemotaxis of neutrophils and monocytesantibacterialantiviralbiofilm disruptionimmune supportgut infectionswound healingLyme diseaseautoimmune |
Research Areas | ImmuneLongevityGut Health & GI RepairPain & Inflammation | ImmuneHealing & RecoveryGut Health & GI RepairPain & InflammationTissue Repair |
Best Stacked With | ll-37thymalinglutathionekpvbac-water | thymosin-alpha-1kpvbpc-157glutathionebac-water |
Overview | ||
Category | Immunity & Wellness | Immunity & Wellness |
Compound Class | 28-amino acid peptide; N-terminal fragment of prothymosin alpha; biological response modifier | Endogenous cationic host defense peptide (cathelicidin family); 37-residue C-terminal fragment of hCAP-18 |
Molecular Target | TLR2/TLR9 signaling; dendritic cell maturation; T-helper (Th1) polarization; NK cell cytotoxicity; NF-kB immunomodulation | Bacterial membrane disruption; TLR4 and FPRL1 receptor signaling; EGFR transactivation; immunomodulatory cytokine network |
Aliases / AKA | ThymalfasinZadaxinTalpha1Tα1Thymosin alpha 1Thymosin α1 | CathelicidinhCAP-18 fragmentCAP-18LL37hCAP18Cathelicidin antimicrobial peptide |
Parent Compound | Prothymosin alpha N-terminal fragment | Human cathelicidin hCAP18 |
Molecular Weight | 3108.3 Da | 4493.3 Da |
Amino Acid Sequence | Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH | [LL-37, 37 aa] |
CAS Number | 62304-98-7 | 154947-66-7 |
Year Discovered | Not Listed | Not Listed |
Pro-Angiogenic | No | No |
GLP-1 Class | No | No |
Purity | Not Listed | Not Listed |
Identity | ||
Evidence Tier | ||
Risk Level | ||
PubMed Citations | 962 Good | 4,770 Extensive |
Clinical Trials | 4141 Active | 2424 Active |
Regulatory Status | Approved as thymalfasin in 30+ countries; not US central-approved. | Not approved; research reagent. |
Evidence & Regulatory | ||
Half-Life | ~2 hours | ~30 minutes |
Typical Frequency | Not Listed | Not Listed |
Administration Route | Injection Only | Injection Only |
Mechanism / PK | Not Listed | Not Listed |
Reported Findings | The most clinically validated peptide in this group: more than 20 human trials and approval in over 30 countries for hepatitis B and C and as a cancer immune adjunct. | In vitro it has broad antimicrobial and LPS-neutralizing activity; animal data show host-defense and wound roles. Human use is investigational. |
Side Effects Noted | Generally well tolerated; injection-site reactions are most common; serious adverse events are uncommon. | Context-dependent host-cell cytotoxicity at higher concentrations; can be pro-inflammatory and has been implicated in lupus and psoriasis pathology; hemolytic potential. |
Warnings | Not centrally US FDA or EMA approved (off-label/investigational in the US, subject to FDA compounding action). Caution in transplant immunosuppression and autoimmunity. | Double-edged immunomodulation can drive autoimmunity; activity is highly salt and serum sensitive. Not approved; research reagent. |
Pharmacology | ||
Form | lyophilized | lyophilized |
Diluent | supplied or sterile diluent | sterile water (salt-sensitive) |
Storage Temp | refrigerate 2-8C, dark; do not freeze the formulated product | frozen, dark |
Light Sensitive | Yes | Yes |
Freeze / Thaw | avoid | avoid |
Handling Notes | N-acetyl group aids stability. | Adsorbs to glass/plastic and aggregates. |
Reconstituted Shelf Life | 14 Days Refrigerated | 14 Days Refrigerated |
Handling & Storage | ||
Pep Nation Lab's comparison tool puts research-grade peptides and compounds head to head - mechanism of action, molecular target, evidence tier, molecular weight, sequence, half-life, and documented research focus - so qualified researchers can evaluate the differences that matter. Every data point is drawn from a referenced monograph. For in vitro laboratory research use only.
The two most-studied research peptides for tissue repair and recovery.
Single GLP-1 versus dual GLP-1/GIP incretin agonists in metabolic research.
Dual versus triple incretin receptor agonists in weight-research models.
A GLP-1 agonist versus a triple-agonist incretin in metabolic research.
A GHRH analog versus a selective ghrelin-receptor secretagogue.
A ghrelin-receptor secretagogue versus a GHRH analog for growth-hormone research.
Two GHRH analogs studied on the growth-hormone axis.
The two first-generation growth-hormone releasing peptides.
An amylin analog versus a GLP-1 agonist in metabolic research.
A mitochondrial-derived peptide versus an HGH fragment in metabolic research.
Melanocortin versus kisspeptin pathways in reproductive research.
A telomerase-pathway peptide versus NAD+ metabolism in longevity research.
A potent versus a highly selective ghrelin-receptor secretagogue.
Two GHRH analogs with contrasting half-life profiles.
A direct IGF-1 analog versus a growth-hormone secretagogue.
The DAC versus non-DAC forms of the CJC-1295 GHRH analog.
Two Russian-developed nootropic and anxiolytic research peptides.
Two mitochondrial-targeted peptides in cellular-energy research.
Two immune-modulating research peptides with distinct mechanisms.
Two HGH-fragment analogs studied for fat-metabolism research.
Next-generation multi-receptor incretin agonists in metabolic research.
Browse the full research catalog or the A To Z index to compare any compound.
Any research-grade compound in the library can be placed side by side - up to four at a time. The tool compares mechanism of action, molecular target, evidence tier, molecular weight, amino acid sequence, reported half-life, and what each compound has been studied for, all drawn from referenced monographs.
The evidence tier reflects how extensively a compound has been studied in the referenced literature, from early preclinical signals through to compounds with human clinical data. It is a research-quality signal only, never a safety or efficacy endorsement.
Each comparison page is generated from the same referenced compound database - a genuine side-by-side of mechanism, identity, pharmacokinetics, and evidence, plus data-derived key differences. They are curated, not auto-generated thin pages.
No. Every comparison is for in vitro laboratory research use only. Nothing here is medical advice, a treatment recommendation, or dosing guidance, and no product is for human or animal consumption.
